PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre03.g160700.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 598aa    MW: 60695.6 Da    PI: 7.6058
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre03.g160700.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA45.41.1e-14334368135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++Cg t++p+WRr   ++  LCnaCG+y+ ++++
  Cre03.g160700.t1.1 334 CAHCGITESPQWRRPLTKKVVLCNACGIYFSRHHS 368
                         **************99****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.9E-10328378IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.662328366IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.57E-11332376No hitNo description
CDDcd002022.27E-11333377No hitNo description
PfamPF003201.2E-11334368IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.9E-12334367IPR013088Zinc finger, NHR/GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MTTRLLDAVS AVRPDGRGGR KRQRTDDVNE ALALALLETV RQALDEGEAN PGCAAVTTSD  60
PSDSTQHDPQ SPPRPSLLPR QHVTSGPHSP QLQASALMPP PQLPPLELAS GRRGVNRRAG  120
SRSREASATQ VPLPQEDAGP LTTNESLSPG AALLAAASAA AAAAGAKLEP GIKEGTGVGT  180
TRQVSPRSRF GCSTIADASA LGASELGYLP PPPLLHLLPL PLPPSPETVV PQPARRGSRT  240
PRGAGTPVAI GLQLHAHQHT HTQGLLLQQQ QQQQQQQQQQ AGSASQSRGS ADTTLAETGT  300
TQEAGEEPEE GEEEAYLPRK RQDKSKVGLP GGPCAHCGIT ESPQWRRPLT KKVVLCNACG  360
IYFSRHHSLP KRKKVRGASA QVIPASAKPI FIPPHKELAP SIICDEKLEL DDTPASAAAR  420
AAIQRVHSLL LPAPALSLAG GGAFSVLGDQ APLASTAAQI AGATGRALLE LSASTRTALS  480
LPLMMALPVV GGINRVVQTY LHPHAVAAVA EGAGAGSAGV CLCGLEALGS GLGGLGVELG  540
CYGVGGLGAL EAAGSHALES GGEEAGGGGG VLPPPGLPSL LSLGAMPSQG SAHGSAL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre03.g160700.t1.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-06GATA transcription factor 26